Enseigner les Sciences de la nature

logo ensl   Logo du ministère de l'éducation
logo CIRI logo Immuniser Lyon
logo LBMC logo Musée Mérieux
Logo Inserm igfl igfl logo CREATIS
Logo du Museum national des histoires naturelles
Logo du musée de Confluences
logo geo 3d
Logo de Lyon 1 logo lgltpe 
Logo du Museum national des histoires naturelles
Logo du musée de Confluences
logo LBMC
logo LBMC
logos composé logo COP In My City logo Investissement d'avenirLogo du musée de Confluences
logo Météo France Logo du musée de Confluences
logo EVSlogo Grand Lyon

Le gluten des farines

La quantité et la qualité du gluten sont recherchées en panification.

Activité pratique autour du gluten.

 

Les protéines des farines de céréales sont classées en protéines solubles, 15 à 20 % des protéines totales et protéines insolubles, 80 à 85 %

Les protéines solubles dans une solution saline diluée sont les albumines et les globulines.

Le gluten est constitué des protéines insolubles dans l'eau mais solubles dans l'alcool à 60 % : les gliadines (40 à 45 % chez les blé) et les gluténines ( 55 à 60 %) .

Les gliadines sont des prolamines responsables des allergies au gluten. L'étiquetage des farines et produits dérivés exige l'information sur la teneur en gluten.

Les gliadines ont une conformation repliée de 35 à 44 000 daltons stabilisée par des ponts dissulfure.

Hydratées, elle forme une pâte visqueuse extensible mais peu élastique.

Les gluténines ont une masse moléculaire de 1 à 3 millions de daltons suivant le nombre et la masse des unités moléculaires qui les constituent ( 16 000 à 149 000 daltons par unité). Elles forment un ensemble allongé qui hydraté donne une masse visqueuse, tenace et élastique.

Pour donner une bonne pâte à pain, la farine doit contenir

  • une proportion de gluten d'au moins 85 % des protéines de la farine
  • un gluten contenant une grande proportion de gluténines
  • des gluténines de haut poids moléculaire

 

L'elasticité de la pâte serait due à la capacité des liaison SS à s'allonger entre les chaines polypeptidiques. Les gluténines ramifiées des céréales autres que le blé empêcheraient cette propriété recherchée en boulangerie.

Des gluténines trop résistantes à l'allongement nécessitent beaucoup d'énergie au pétrissage. On peut leur ajouter des agents réducteurs qui facilitent les échanges entre ponts SS.

Des agents oxydants favorisent la formation des ponts dissulfure et donc améliorent l'élasticité des gluténines trop faibles.

Séquence en acides aminés de la gluténine de triticum aestivum et d'Aegilops tauschii X

 les vingt premiers acides aminés constituent le peptide signal.

>sp|P10386|GLTB_WHEAT Glutenin, low molecular weight subunit 1D1 OS=Triticum aestivum PE=2 SV=1
MKTFLVFALLAVAATSAIAQMETRCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQQQLFP
QQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSP
FPQQQQQHQQLVQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHV
MQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQ
SQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGV
GTGVGAY

 

>tr|Q6J6U8|Q6J6U8_AEGTA Low molecular weight glutenin subunit LMW.S13 OS=Aegilops tauschii PE=4 SV=1
MKTFLVFALLAVAATSAIAQMETRCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQLFPQQ
PSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFP
QQQQQHQQLVQQQIPVVQPSILQQLNPCKLFLQQQCSPVAMPQRLARSQMLQQSSCHVMQ
QQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQ
QQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCRVNVPLYRTTTSVPFGVGT
GVGAY

alignement des séquences pour comparaison :

MKTFLVFALLAVAATSAIAQMETRCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQQQLFP    60
MKTFLVFALLAVAATSAIAQMETRCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQ - - LFP    58

QQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSP   120
QQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSP   118

FPQQQQQHQQLVQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHV   180
FPQQQQQHQQLVQQQIPVVQPSILQQLNPCKLFLQQQCSPVAMPQRLARSQMLQQSSCHV   178

MQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQ   240
MQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQ   238

SQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGV   300
SQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCRVNVPLYRTTTSVPFGV   298

GTGVGAY   307 P10386  triticum
GTGVGAY   305 Q6J6U8  aegilops

 

séquence de l'alpha gliadine de blé (Triticum aestivum) et d'Aegilops tauschii

>tr|J7I021|J7I021_WHEAT Alpha-gliadin OS=Triticum aestivum GN=Gli-CS-3 PE=4 SV=1
MKTFLILALLAVVATTATIAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQPFPPQ
RPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPHLPYPQPQPFRPQQPYPQPQPQYSQPQQP
ISQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHSIAHGSSQVLLQSTYQLVQQLCCQ
QLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQQQQQQPLSQVSFQRPQQQYPSGQGSFQ
PSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIAPVGIFGTN

 

>tr|I3RXV6|I3RXV6_AEGTA Alpha-gliadin protein OS=Aegilops tauschii GN=gli-1 PE=4 SV=1
MKTFLILSLLAIVATTATIAVRVPVPPLQPQNPSQQQPQEQVPLVQQQQFPGQQQPFPPQ
QPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQLLYPQPQPFRPQQPYPQPQPQYSQPQQP
ISQQQQQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHSIAHGSSQVLQQSTYQLV
QQLCCQQLWQIPEQSRYQAIHNVVHAIILHQQQQQQQQQQQQQQPLSQVSFQQPQQQYPS
GQGSFQPSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIAPVGIFGTN

fichier 3D du peptide 243 à 260 de la gliadine couplée à un recepteur T humain :

références pdb du modèle : 4GG6

http://www.pdb.org/pdb/explore/explore.do?structureId=4GG6